PDB entry 1nwj

View 1nwj on RCSB PDB site
Description: solution structure of hypothetical arabidopsis thaliana protein at3g17210. center for eukaryotic structural genomics target 13081
Class: structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2003-02-06, released 2003-06-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2003-08-19, with a file datestamp of 2007-04-25.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: expressed protein: At3g17210.1
  Species: Arabidopsis thaliana
  Database cross-references and differences (RAF-indexed):
  • GB NP_566569 (3-111)
    • cloning artifact (0-2)
  Domains in SCOPe 2.08: d1nwja1, d1nwja2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nwjA (A:)
  gshmeeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlh
  qgythifestfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl