PDB entry 1nsj

View 1nsj on RCSB PDB site
Description: crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima
Class: isomerase
Keywords: isomerase, phosphoribosyl anthranilate isomerase, thermostability
Deposited on 1996-09-13, released 1997-03-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosyl anthranilate isomerase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TRPF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nsja_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nsjA (A:)
    mvrvkicgitnledalfsvesgadavgfvfypkskryispedarrisvelppfvfrvgvf
    vneepekildvasyvqlnavqlhgeepielcrkiaerilvikavgvsnerdmeralnyre
    fpilldtktpeyggsgktfdwslilpyrdrfrylvlsgglnpenvrsaidvvrpfavdvs
    sgveafpgkkdhdsikmfiknakgl