PDB entry 1nmw

View 1nmw on RCSB PDB site
Description: Solution structure of the PPIase domain of human Pin1
Class: isomerase
Keywords: PPIase domain, beta-alpha, a1/b1 loop, sulphate, ISOMERASE
Deposited on 2003-01-12, released 2003-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-09, with a file datestamp of 2011-03-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nmwa_
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nmwA (A:)
    geparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasq
    fsdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte