PDB entry 1nmv

View 1nmv on RCSB PDB site
Description: Solution structure of human Pin1
Class: isomerase
Keywords: PPIase domain, WW domain group IV, beta-alpha, ISOMERASE
Deposited on 2003-01-11, released 2003-08-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIN1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1nmva1, d1nmva2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nmvA (A:)
    madeeklppgwekrmsrssgrvyyfnhitnasqwerpsgnsssggkngqgeparvrcshl
    lvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqfsdcssakarg
    dlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte