PDB entry 1nmr

View 1nmr on RCSB PDB site
Description: Solution Structure of C-terminal Domain from Trypanosoma cruzi Poly(A)-Binding Protein
Class: peptide binding protein
Keywords: All helical domain, PEPTIDE BINDING PROTEIN
Deposited on 2003-01-10, released 2003-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: poly(A)-binding protein
  Species: Trypanosoma cruzi [TaxId:5693]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q27335 (2-84)
    • cloning artifact (0-1)
  Domains in SCOPe 2.07: d1nmra1, d1nmra2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nmrA (A:)
  gsslasqgqnlstvlanltpeqqknvlgerlynhivainpaaaakvtgmllemdngeiln
  lldtpglldakvqealevlnrhmnv