PDB entry 1nkw

View 1nkw on RCSB PDB site
Description:
Deposited on 2003-01-05, released 2003-02-11
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-11, with a file datestamp of 2003-02-11.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.24
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkw0_
  • Chain '1':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkw1_
  • Chain '2':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkw2_
  • Chain '3':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkw3_
  • Chain '4':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkw4_
  • Chain '9':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkw9_
  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwd_
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwe_
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwf_
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwg_
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwh_
  • Chain 'I':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwi_
  • Chain 'J':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwj_
  • Chain 'K':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwk_
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwl_
  • Chain 'M':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwm_
  • Chain 'N':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwn_
  • Chain 'O':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwo_
  • Chain 'P':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwp_
  • Chain 'Q':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwq_
  • Chain 'R':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwr_
  • Chain 'S':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkws_
  • Chain 'T':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwt_
  • Chain 'U':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwu_
  • Chain 'W':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkww_
  • Chain 'X':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwx_
  • Chain 'Y':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwy_
  • Chain 'Z':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1nkwz_

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkw1 (1:)
    akdgpriivkmessagtgfyytttknrrntqaklelkkydpvakkhvvfrekk
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkw2 (2:)
    mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkw3 (3:)
    pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
    lpr
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkw4 (4:)
    kvrssvkkmcdnckvvrrhgrvlvicsnvkhkqrq
    

  • Chain '9':
    No sequence available.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwA (A:)
    kkyrpytpsrrqmttadfsgltkkrpekaltealpktggrnnrgritsrfiggghkrlyr
    iidfkrrdksgvnakvaaieydpnrsariallhyadgekryilapegltvgatvnagpea
    epklgnalplrfvpvgavvhalelvpgkgaqlarsagtsvqvqgkesdyvivrlpsgelr
    rvhsecyatigavgnaehknivlgkagrsrwlgrkphqrgsamnpvdhphgggegrtgag
    rvpvtpwgkptkglktrrkrktsdrfivtr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwB (B:)
    mkgilgtkigmtqiwkndraipvtvvlagpcpivqrktaqtdgyeavqigyapkaerkvn
    kpmqghfakagvaptrilrefrgfapdgdsvnvdifaegekidatgtskgkgtqgvmkrw
    nfaggpashgskkwhrrpgsigqrktpgrvykgkrmaghmgmervtvqnlevveiragen
    lilvkgaipgangglvvlrsaakas
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwC (C:)
    aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
    kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
    gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
    rhdrlvidaaaleivee
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwD (D:)
    qqlktkyndqvrpalmqqfgyssvmavpriekivvneglgsskedskaidkaakelalit
    lqkpiitkakksisnfklrqgmpvgikvtlrgermyvflekliniglprirdfrginpna
    fdgrgnynlgikeqlifpeitydmvdktrgmditivttaktdeearallqsmglpfrk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwE (E:)
    gkqpiavpsgvtvnaqdgvfkvkgpkgeltvpynteltvrqdgdqllverpsdaqkhral
    hgltrtlvanavkgvsdgytinlelrgvgfrakltgkalemnigyshpviieppagvtfa
    vpeptridvsgidkqlvgqvaanvrkvrkpdayhgkgvrfvgeqialkagkagatgg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwF (F:)
    mqvillepsrlgktgevvsvkdgyarnwlipqglavsatrtnmktleaqlrs
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwG (G:)
    mkkvagivklqlpagkatpappvgpalgqyganimeftkafnaqtadkgdaiipveitiy
    adrsftfitktppmsylirkaagigkgsstpnkakvgklnwdqvleiaktkmpdlnagsv
    eaaantvagtarsmgvtveggpn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwH (H:)
    vktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqv
    altgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrl
    kvyagethphsaqkpqvlktqpl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwI (I:)
    impqsrldvadnsgareimcirvlnsgiggkglttggggnkryahvgdiivasvkdaapr
    gavkagdvvkavvvrtshaikradgstirfdrnaaviinnqgeprgtrvfgpvarelrdr
    rfmkivslapev
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwJ (J:)
    hdlkptpgsrkdrkrvgrgpggtdktagrghkgqksrsgagkgaffeggrsrliarlpkr
    gfnnvgttyevvklsqlqdledttfdrdtleayrlvrrknrpvkllasgeisravtvhvd
    aasaaaikaveaaggrvvlpe
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwK (K:)
    tkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggkiyi
    rifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghklp
    iqtk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwL (L:)
    hgkagrklnrnssarvalaraqatallregriqttltkakelrpfveqlittakggdlhs
    rrlvaqdihdkdvvrkvmdevapkyaerpggytrilrvgtrrgdgvtmalielv
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwM (M:)
    attirrklrtrrkvrtttaasgrlrlsvyrsskhiyaqiiddsrgqtlaaassaalksgn
    ktdtaaavgkalaaaaaekgikqvvfdrgsykyhgrvkaladaareggldf
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwN (N:)
    qthikinrgellrgieqdhtrqlpdfrpgdtvrvdtkvregnrtrsqafegvviaingsg
    srksftvrkisfgegvervfpfasplvnqvtivergkvrraklyylrelrgkaariksdr
    srvmk
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwO (O:)
    praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
    iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwP (P:)
    mfaiiqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaev
    vehgrgkkiyirkyksgvqyrrrtghrqnftaikilgiqg
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwQ (Q:)
    eqtfrnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfiprsa
    sepvakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkrtshi
    tiivaekgnk
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwR (R:)
    shydilqapvisekaysamergvysfwvspkatkteikdaiqqafgvrvigistmnvpgk
    rkrvgrfigqrndrkkaivrlaegqsiealagq
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwS (S:)
    prpsagshhndklhfkkgdtvivlsgkhkgqtgkvllalprdqkvvvegvnvitknvkps
    mtnpqggqeqrelalhaskvalvdpetgkatrvrkqivdgkkvrvavasgkti
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwT (T:)
    meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
    tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
    qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlpprltaee
    leaevqaaqvaglvaagelseeaaeavlegdasleevkaease
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwU (U:)
    ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
    lsdgkvvfinkgkgarfisieaaqte
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwW (W:)
    kpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkaela
    rkgeq
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwX (X:)
    mkiklvrsvigrpgnqvktvqalglrkigdsrevsdtpavrgmvktvkhllevqe
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwY (Y:)
    mqkdlhpkavpckiiyqgqvvmetmstrpeihvdvwsgvhpfwtgeerfldtegrvdkfn
    krfgdsyrrgskk
    

  • Chain 'Z':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkwZ (Z:)
    akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla