PDB entry 1nku

View 1nku on RCSB PDB site
Description: NMR Solution Structure of Zinc-binding protein 3-methyladenine DNA glycosylase I (TAG)
Class: hydrolase
Keywords: hydrolase
Deposited on 2003-01-03, released 2003-06-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-Methyladenine Dna Glycosylase I (TAG)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1nkua_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nkuA (A:)
    mercgwvsqdplyiayhdnewgvpetdskklfemiclegqqaglswitvlkkrenyracf
    hqfdpvkvaamqeedverlvqdagiirhrgkiqaiignaraylqmeqngepfadfvwsfv
    nhqpqmtqattlseiptstpasdalskalkkrgfkfvgtticysfmqacglvndhvvgcc
    cypgnkp