PDB entry 1nhy

View 1nhy on RCSB PDB site
Description: crystal structure of the gst-like domain of elongation factor 1-gamma from saccharomyces cerevisiae.
Deposited on 2002-12-20, released 2003-01-14
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-14, with a file datestamp of 2003-01-14.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.235
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nhyA (A:)
    msqgtlyanfrirtwvprglvkalkldvkvvtpdaaaeqfardfplkkvpafvgpkgykl
    teamainyylvklsqddkmktqllgadddlnaqaqiirwqslansdlciqiantivplkg
    gapynkksvdsamdavdkivdifenrlknytylatenisladlvaasiftryfeslfgte
    wraqhpaivrwfntvraspflkdeykdfkfadkplsppq