PDB entry 1nei

View 1nei on RCSB PDB site
Description: Solution NMR Structure of Protein yoaG from Escherichia coli. Ontario Centre for Structural Proteomics Target EC0264_1_60; Northeast Structural Genomics Consortium Target ET94.
Class: Structural genomics, unknown function
Keywords: Alpha/Beta protein, homodimer, OCSP, NESG, PROTEIN STRUCTURE INITIATIVE, structural genomics, PSI, Northeast Structural Genomics Consortium, unknown function
Deposited on 2002-12-11, released 2004-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein yoaG
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1neia_
  • Chain 'B':
    Compound: hypothetical protein yoaG
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1neib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1neiA (A:)
    mgkatytvtvtnnsngvsvdyetetpmtllvpevaaevikdlvntvrsydtenehdvcgw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1neiB (B:)
    mgkatytvtvtnnsngvsvdyetetpmtllvpevaaevikdlvntvrsydtenehdvcgw