SCOPe 2.08: Domain d1neia_: 1nei A:

Lineage for d1neia_ (1nei A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.253: Hypothetical protein YoaG [103062] (1 superfamily)
   dimer of beta(2)-alpha motifs ; 2 layers, alpha/beta; reverse MinE topology

4. Superfamily d.253.1: Hypothetical protein YoaG [103063] (1 family)
   automatically mapped to Pfam PF08956

5. Family d.253.1.1: Hypothetical protein YoaG [103064] (1 protein)

6. Protein Hypothetical protein YoaG [103065] (1 species)

7. Species Escherichia coli [TaxId:562] [103066] (1 PDB entry)

8. Domain d1neia_: 1nei A: [91843]

Details for d1neia_

PDB Entry: 1nei

PDB Description: solution nmr structure of protein yoag from escherichia coli. ontario centre for structural proteomics target ec0264_1_60; northeast structural genomics consortium target et94.

PDB Compounds: (A:) hypothetical protein yoaG

SCOPe Domain Sequences for d1neia_:

Sequence; same for both SEQRES and ATOM records:

>d1neia_ d.253.1.1 (A:) Hypothetical protein YoaG {Escherichia coli [TaxId: 562]}
mgkatytvtvtnnsngvsvdyetetpmtllvpevaaevikdlvntvrsydtenehdvcgw

Timeline for d1neia_:

• d1neia_ first appeared in SCOP 1.67
  
• d1neia_ appears in SCOPe 2.07