PDB entry 1ne8

View 1ne8 on RCSB PDB site
Description: YDCE protein from Bacillus subtilis
Class: structural genomics, unknown function
Keywords: conserved hypothetical protein YDCE, STRUCTURAL GENOMICS, New York SGX Research Center for Structural Genomics, PSI, Protein Structure Initiative, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2002-12-10, released 2003-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: conserved hypothetical protein YDCE
  Species: Bacillus subtilis [TaxId:1423]
  Gene: ydcE
  Database cross-references and differences (RAF-indexed):
  • Uniprot P96622 (2-116)
    • cloning artifact (1)
  Domains in SCOPe 2.07: d1ne8a1, d1ne8a2
• Heterogens: 1PG, ACY, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1ne8A (A:)
  slivkrgdvyfadlspvvgseqggvrpvlviqndignrfsptaivaaitaqiqkaklpth
  veidakrygferdsvilleqirtidkqrltdkithlddemmdkvdealqislalidf
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1ne8A (A:)
  livkrgdvyfadlspvvgseqggvrpvlviqndignrfsptaivaaitaqiqkaklpthv
  eidakrygferdsvilleqirtidkqrltdkithlddemmdkvdealqislalidf