PDB entry 1ncl

View 1ncl on RCSB PDB site
Description: thermal stability of hexameric and tetrameric nucleoside, diphosphate kinases
Deposited on 1996-03-22, released 1996-11-08
The last revision prior to the SCOP 1.63 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.181
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1ncl__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ncl_ (-)
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasaggsirgdfgvdvgrniihgsd
svesanreialwfkpeelltevkpnpnlye