PDB entry 1nas

View 1nas on RCSB PDB site
Description: sepiapterin reductase complexed with n-acetyl serotonin
Class: oxidoreductase
Keywords: sepiapterin reductase, oxidoreductase, short-chain dehydrogenase, sdr family, n-acetyl serotonin, tetrahydrobiopterin
Deposited on 1998-03-26, released 1999-03-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.166
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sepiapterin reductase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1nasa_
  • Heterogens: OAA, NAP, ASE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nasA (A:)
adglgcavcvltgasrgfgralapqlarllspgsvmlvsarsesmlrqlkeelgaqqpdl
kvvlaaadlgteagvqrllsavrelprpeglqrlllinnaatlgdvskgflnvndlaevn
nywalnltsmlcltsgtlnafqdspglsktvvnisslcalqpykgwglycagkaardmly
qvlaaeepsvrvlsyapgpldndmqqlaretskdpelrsklqklksdgalvdcgtsaqkl
lgllqkdtfqsgahvdfyd