PDB entry 1nam

View 1nam on RCSB PDB site
Description: murine alloreactive scfv tcr-peptide-MHC class I molecule complex
Class: immune system
Keywords: T cell receptor, class I MHC, H-2Kb, TCR-pMHC complex, alloreactivity, crossreactivity, IMMUNE SYSTEM
Deposited on 2002-11-28, released 2003-03-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.237
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BM3.3 T Cell Receptor alpha-Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NAM (0-115)
    Domains in SCOPe 2.06: d1nama_
  • Chain 'B':
    Compound: BM3.3 T Cell Receptor beta-Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NAM (0-111)
    Domains in SCOPe 2.06: d1namb_
  • Chain 'H':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain precursor
    Species: Mus musculus [TaxId:10090]
    Gene: H2-K
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1namh1, d1namh2
  • Chain 'L':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01887 (1-99)
      • cloning artifact (0)
    Domains in SCOPe 2.06: d1naml1, d1naml2
  • Chain 'P':
    Compound: Nucleocapsid
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1namA (A:)
    qkvtqtqtsisvmekttvtmdcvyetqdssyflfwykqtasgeivflirqdsykkenatv
    ghyslnfqkpkssigliitatqiedsavyfcamrgdyggsgnklifgtgtllsvkp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1namB (B:)
    vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
    lpgadylatrvtdtelrlqvanmsqgrtlyctcsadrvgntlyfgegsrlivv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1namH (H:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrwe
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1namL (L:)
    miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
    wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'P':
    No sequence available.