PDB entry 1n1x

View 1n1x on RCSB PDB site
Description: Crystal Structure Analysis of the monomeric [S-carboxyamidomethyl-Cys31, S-carboxyamidomethyl-Cys32] Bovine seminal ribonuclease
Class: hydrolase
Keywords: Hydrolase
Deposited on 2002-10-21, released 2003-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.205
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease, seminal
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00669 (0-123)
      • modified residue (30-31)
    Domains in SCOPe 2.07: d1n1xa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1n1xA (A:)
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

    Sequence, based on observed residues (ATOM records): (download) 
    >1n1xA (A:)
kesaaakferqhmdsgssnycnlmmccrkmtqgkckpvntfvhesladvkavcsqkkvtc
kngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhfdasv