PDB entry 1n13

View 1n13 on RCSB PDB site
Description: The Crystal Structure of Pyruvoyl-dependent Arginine Decarboxylase from Methanococcus jannashii
Class: lyase
Keywords: pyruvoyl group, pyruvate, arginine decarboxylase, agmatine, arginine, LYASE
Deposited on 2002-10-16, released 2003-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.192
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pyruvoyl-dependent arginine decarboxylase beta chain
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Gene: MJ0316
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57764 (Start-51)
  Domains in SCOPe 2.06: d1n13.1
• Chain 'B':
  Compound: pyruvoyl-dependent arginine decarboxylase alpha chain
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Gene: MJ0316
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57764 (0-112)
    • see remark 999 (0)
  Domains in SCOPe 2.06: d1n13.1
• Chain 'C':
  Compound: pyruvoyl-dependent arginine decarboxylase beta chain
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Gene: MJ0316
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57764 (Start-51)
  Domains in SCOPe 2.06: d1n13.2
• Chain 'D':
  Compound: pyruvoyl-dependent arginine decarboxylase alpha chain
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Gene: MJ0316
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57764 (0-112)
    • see remark 999 (0)
  Domains in SCOPe 2.06: d1n13.2
• Chain 'E':
  Compound: pyruvoyl-dependent arginine decarboxylase beta chain
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Gene: MJ0316
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57764 (Start-51)
  Domains in SCOPe 2.06: d1n13.3
• Chain 'F':
  Compound: pyruvoyl-dependent arginine decarboxylase alpha chain
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Gene: MJ0316
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57764 (0-112)
    • see remark 999 (0)
  Domains in SCOPe 2.06: d1n13.3
• Chain 'G':
  Compound: pyruvoyl-dependent arginine decarboxylase beta chain
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Gene: MJ0316
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57764 (Start-51)
  Domains in SCOPe 2.06: d1n13.4
• Chain 'H':
  Compound: pyruvoyl-dependent arginine decarboxylase alpha chain
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Gene: MJ0316
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57764 (0-112)
    • see remark 999 (0)
  Domains in SCOPe 2.06: d1n13.4
• Chain 'I':
  Compound: pyruvoyl-dependent arginine decarboxylase beta chain
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Gene: MJ0316
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57764 (Start-51)
  Domains in SCOPe 2.06: d1n13.5
• Chain 'J':
  Compound: pyruvoyl-dependent arginine decarboxylase alpha chain
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Gene: MJ0316
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57764 (0-112)
    • see remark 999 (0)
  Domains in SCOPe 2.06: d1n13.5
• Chain 'K':
  Compound: pyruvoyl-dependent arginine decarboxylase beta chain
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Gene: MJ0316
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57764 (Start-51)
  Domains in SCOPe 2.06: d1n13.6
• Chain 'L':
  Compound: pyruvoyl-dependent arginine decarboxylase alpha chain
  Species: Methanocaldococcus jannaschii [TaxId:2190]
  Gene: MJ0316
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q57764 (0-112)
    • see remark 999 (0)
  Domains in SCOPe 2.06: d1n13.6
• Heterogens: AG2, MRD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1n13A (A:)
  mnaeinplhayfklpntvslvagssegetplnafdgallnagignvnliris
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1n13A (A:)
  plhayfklpntvslvagssegetplnafdgallnagignvnliris
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1n13B (B:)
  ximppeaeivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyeg
  kcskkeaektvremakigfemrgweldriesiavehtveklgcafaaaalwyk
  

  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >1n13C (C:)
  mnaeinplhayfklpntvslvagssegetplnafdgallnagignvnliris
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1n13C (C:)
  inplhayfklpntvslvagssegetplnafdgallnagignvnliris
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1n13D (D:)
  ximppeaeivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyeg
  kcskkeaektvremakigfemrgweldriesiavehtveklgcafaaaalwyk
  

  
  
• Chain 'E':
  Sequence, based on SEQRES records: (download)
  

  >1n13E (E:)
  mnaeinplhayfklpntvslvagssegetplnafdgallnagignvnliris
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1n13E (E:)
  aeinplhayfklpntvslvagssegetplnafdgallnagignvnliris
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1n13F (F:)
  ximppeaeivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyeg
  kcskkeaektvremakigfemrgweldriesiavehtveklgcafaaaalwyk
  

  
  
• Chain 'G':
  Sequence, based on SEQRES records: (download)
  

  >1n13G (G:)
  mnaeinplhayfklpntvslvagssegetplnafdgallnagignvnliris
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1n13G (G:)
  fklpntvslvagssegetplnafdgallnagignvnliris
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1n13H (H:)
  ximppeaeivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyeg
  kcskkeaektvremakigfemrgweldriesiavehtveklgcafaaaalwyk
  

  
  
• Chain 'I':
  Sequence, based on SEQRES records: (download)
  

  >1n13I (I:)
  mnaeinplhayfklpntvslvagssegetplnafdgallnagignvnliris
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1n13I (I:)
  einplhayfklpntvslvagssegetplnafdgallnagignvnliris
  

  
  
• Chain 'J':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1n13J (J:)
  ximppeaeivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyeg
  kcskkeaektvremakigfemrgweldriesiavehtveklgcafaaaalwyk
  

  
  
• Chain 'K':
  Sequence, based on SEQRES records: (download)
  

  >1n13K (K:)
  mnaeinplhayfklpntvslvagssegetplnafdgallnagignvnliris
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1n13K (K:)
  ayfklpntvslvagssegetplnafdgallnagignvnliris
  

  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1n13L (L:)
  ximppeaeivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyeg
  kcskkeaektvremakigfemrgweldriesiavehtveklgcafaaaalwyk