PDB entry 1n13

View 1n13 on RCSB PDB site
Description: The Crystal Structure of Pyruvoyl-dependent Arginine Decarboxylase from Methanococcus jannashii
Class: lyase
Keywords: pyruvoyl group, pyruvate, arginine decarboxylase, agmatine, arginine, LYASE
Deposited on 2002-10-16, released 2003-03-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.192
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvoyl-dependent arginine decarboxylase beta chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1n13.1
  • Chain 'B':
    Compound: pyruvoyl-dependent arginine decarboxylase alpha chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57764 (0-112)
      • see remark 999 (0)
    Domains in SCOPe 2.04: d1n13.1
  • Chain 'C':
    Compound: pyruvoyl-dependent arginine decarboxylase beta chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1n13.2
  • Chain 'D':
    Compound: pyruvoyl-dependent arginine decarboxylase alpha chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57764 (0-112)
      • see remark 999 (0)
    Domains in SCOPe 2.04: d1n13.2
  • Chain 'E':
    Compound: pyruvoyl-dependent arginine decarboxylase beta chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1n13.3
  • Chain 'F':
    Compound: pyruvoyl-dependent arginine decarboxylase alpha chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57764 (0-112)
      • see remark 999 (0)
    Domains in SCOPe 2.04: d1n13.3
  • Chain 'G':
    Compound: pyruvoyl-dependent arginine decarboxylase beta chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1n13.4
  • Chain 'H':
    Compound: pyruvoyl-dependent arginine decarboxylase alpha chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57764 (0-112)
      • see remark 999 (0)
    Domains in SCOPe 2.04: d1n13.4
  • Chain 'I':
    Compound: pyruvoyl-dependent arginine decarboxylase beta chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1n13.5
  • Chain 'J':
    Compound: pyruvoyl-dependent arginine decarboxylase alpha chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57764 (0-112)
      • see remark 999 (0)
    Domains in SCOPe 2.04: d1n13.5
  • Chain 'K':
    Compound: pyruvoyl-dependent arginine decarboxylase beta chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1n13.6
  • Chain 'L':
    Compound: pyruvoyl-dependent arginine decarboxylase alpha chain
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: MJ0316
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57764 (0-112)
      • see remark 999 (0)
    Domains in SCOPe 2.04: d1n13.6
  • Heterogens: AG2, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1n13A (A:)
    mnaeinplhayfklpntvslvagssegetplnafdgallnagignvnliris
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n13A (A:)
    plhayfklpntvslvagssegetplnafdgallnagignvnliris
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n13B (B:)
    ximppeaeivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyeg
    kcskkeaektvremakigfemrgweldriesiavehtveklgcafaaaalwyk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1n13C (C:)
    mnaeinplhayfklpntvslvagssegetplnafdgallnagignvnliris
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n13C (C:)
    inplhayfklpntvslvagssegetplnafdgallnagignvnliris
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n13D (D:)
    ximppeaeivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyeg
    kcskkeaektvremakigfemrgweldriesiavehtveklgcafaaaalwyk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1n13E (E:)
    mnaeinplhayfklpntvslvagssegetplnafdgallnagignvnliris
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n13E (E:)
    aeinplhayfklpntvslvagssegetplnafdgallnagignvnliris
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n13F (F:)
    ximppeaeivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyeg
    kcskkeaektvremakigfemrgweldriesiavehtveklgcafaaaalwyk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1n13G (G:)
    mnaeinplhayfklpntvslvagssegetplnafdgallnagignvnliris
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n13G (G:)
    fklpntvslvagssegetplnafdgallnagignvnliris
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n13H (H:)
    ximppeaeivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyeg
    kcskkeaektvremakigfemrgweldriesiavehtveklgcafaaaalwyk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1n13I (I:)
    mnaeinplhayfklpntvslvagssegetplnafdgallnagignvnliris
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n13I (I:)
    einplhayfklpntvslvagssegetplnafdgallnagignvnliris
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n13J (J:)
    ximppeaeivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyeg
    kcskkeaektvremakigfemrgweldriesiavehtveklgcafaaaalwyk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1n13K (K:)
    mnaeinplhayfklpntvslvagssegetplnafdgallnagignvnliris
    

    Sequence, based on observed residues (ATOM records): (download)
    >1n13K (K:)
    ayfklpntvslvagssegetplnafdgallnagignvnliris
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1n13L (L:)
    ximppeaeivplpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyeg
    kcskkeaektvremakigfemrgweldriesiavehtveklgcafaaaalwyk