PDB entry 1mzp

View 1mzp on RCSB PDB site
Description: Structure of the L1 protuberance in the ribosome
Class: ribosome
Keywords: ribosome, ribosomal protein, RNA-protein complex
Deposited on 2002-10-09, released 2003-01-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.219
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50s ribosomal protein l1p
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35024 (1-216)
      • cloning artifact (0)
      • modified residue (40)
      • conflict (104)
      • modified residue (116)
      • conflict (155)
      • modified residue (173)
      • modified residue (208)
    Domains in SCOPe 2.06: d1mzpa1, d1mzpa2
  • Chain 'B':
    Compound: fragment of 23s rRNA
    Species: synthetic, synthetic
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mzpA (A:)
mladkesliealklalsteynvkrnftqsveiiltfkgidmkkgdlklreivplpkqpsk
akrvlvvpsseqleyakkaspkvvitreelqklqgqkrpvkklarqnewflinqesmala
grilgpalgprgkfptplpntadiseyinrfkrsvlvktkdqpqvqvfigtedmkpedla
enaiavlnaienkakvetnlrniyvkttmgkavkvkr

  • Chain 'B':
    No sequence available.