PDB entry 1myt

View 1myt on RCSB PDB site
Description: crystal structure to 1.74 angstroms resolution of metmyoglobin from yellowfin tuna (thunnus albacares): an example of a myoglobin lacking the d helix
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1991-05-06, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.177
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Thunnus albacares [TaxId:8236]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1myta_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mytA (A:)
    adfdavlkcwgpveadyttmgglvltrlfkehpetqklfpkfagiaqadiagnaaisahg
    atvlkklgellkakgshaailkplanshatkhkipinnfklisevlvkvmhekagldagg
    qtalrnvmgiiiadleanykelgfsg