PDB entry 1mxl

View 1mxl on RCSB PDB site
Description: structure of cardiac troponin c-troponin I complex
Class: calcium-binding protein
Keywords: troponin, muscle contraction, regulatory protein, calcium-binding protein
Deposited on 1999-04-22, released 1999-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'C':
  Compound: protein (troponin c)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P63316 (0-88)
  Domains in SCOPe 2.07: d1mxlc_
• Chain 'I':
  Compound: protein (troponin I)
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19429 (0-16)
  Domains in SCOPe 2.07: d1mxli_
• Heterogens: CA

PDB Chain Sequences:

• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mxlC (C:)
  mddiykaaveqlteeqknefkaafdifvlgaedgcistkelgkvmrmlgqnptpeelqem
  idevdedgsgtvdfdeflvmmvrcmkdds
  

  
  
• Chain 'I':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mxlI (I:)
  risadammqallgarak