PDB entry 1mwk

View 1mwk on RCSB PDB site
Description: ParM from plasmid R1 APO form
Class: structural protein
Keywords: plasmid, plasmid partition, STRUCTURAL PROTEIN
Deposited on 2002-09-30, released 2003-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ParM
    Species: Escherichia coli [TaxId:562]
    Gene: parM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mwka1, d1mwka2
  • Chain 'B':
    Compound: ParM
    Species: Escherichia coli [TaxId:562]
    Gene: parM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mwkb1, d1mwkb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mwkA (A:)
    mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
    spdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenie
    rkkanfrkkitlnggdtftikdvkvmpesipagyevlqeldeldslliidlggttldisq
    vmgklsgiskiygdsslgvslvtsavkdalslartkgssyladdiiihrkdnnylkqrin
    denkisivteamnealrkleqrvlntlnefsgythvmvigggaelicdavkkhtqirder
    ffktnnsqydlvngmylign
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mwkB (B:)
    mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
    spdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenie
    rkkanfrkkitlnggdtftikdvkvmpesipagyevlqeldeldslliidlggttldisq
    vmgklsgiskiygdsslgvslvtsavkdalslartkgssyladdiiihrkdnnylkqrin
    denkisivteamnealrkleqrvlntlnefsgythvmvigggaelicdavkkhtqirder
    ffktnnsqydlvngmylign
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mwkB (B:)
    mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
    spdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenie
    rkkanfrkkitlnggdtftikdvkvmpesipagyevlqeldeldslliidlggttldisq
    vmgklsgiskiygdsslgvslvtsavkdalsgssyladdiiihrkdnnylkqrindenki
    sivteamnealrkleqrvlntlnefsgythvmvigggaelicdavkkhtqirderffktn
    nsqydlvngmylig