PDB entry 1mu0

View 1mu0 on RCSB PDB site
Description: Crystal Structure of the Tricorn Interacting Factor F1 Complex with PCK
Class: hydrolase
Keywords: alpha-beta hydrolase, cap domain, caged active site, prolyl peptidase
Deposited on 2002-09-23, released 2002-11-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.314
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proline iminopeptidase
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: TA0830
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mu0a_
  • Heterogens: PHK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mu0A (A:)
mdqecienyakvngiyiyyklckapeekaklmtmhggpgmshdyllslrdmtkegitvlf
ydqfgcgrseepdqskftidygveeaealrsklfgnekvflmgssyggalalayavkyqd
hlkglivsgglssvpltvkemnrlidelpakyrdaikkygssgsyenpeyqeavnyfyhq
hllrsedwppevlksleyaerrnvyrimngpneftitgtikdwditdkisaikiptlitv
geydevtpnvarvihekiagselhvfrdcshltmwedregynkllsdfilkhl