PDB entry 1mtx

View 1mtx on RCSB PDB site
Description: determination of the three-dimensional structure of margatoxin by 1h, 13c, 15n triple-resonance nuclear magnetic resonance spectroscopy
Deposited on 1994-12-27, released 1995-11-14
The last revision prior to the SCOP 1.59 freeze date was dated 1995-11-14, with a file datestamp of 1995-11-15.
Experiment type: NMR23
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1mtx__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mtx_ (-)
    tiinvkctspkqclppckaqfgqsagakcmngkckcyph