PDB entry 1msc

View 1msc on RCSB PDB site
Description: crystal structure of ms2 coat protein dimer
Class: Viral protein
Keywords: TRANSLATION REPRESSOR, Viral protein
Deposited on 1995-04-28, released 1995-07-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriophage ms2 coat protein
    Species: Enterobacterio phage MS2 [TaxId:12022]
    Gene: MS2 COAT GENE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03612 (0-128)
      • conflict (81)
    Domains in SCOPe 2.06: d1msca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mscA (A:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaarrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy