PDB entry 1mrj

View 1mrj on RCSB PDB site
Description: studies on crystal structures active center geometry and depurine mechanism of two ribosome-inactivating proteins
Class: ribosome-inactivating protein
Keywords: ribosome-inactivating protein
Deposited on 1994-07-01, released 1995-02-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.173
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-trichosanthin
    Species: Trichosanthes kirilowii [TaxId:3677]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1mrja_
  • Heterogens: ADN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mrjA (A:)
dvsfrlsgatsssygvfisnlrkalpnerklydipllrsslpgsqryalihltnyadeti
svaidvtnvyimgyragdtsyffneasateaakyvfkdamrkvtlpysgnyerlqtaagk
ireniplglpaldsaittlfyynansaasalmvliqstseaarykfieqqigkrvdktfl
pslaiislenswsalskqiqiastnngqfespvvlinaqnqrvtitnvdagvvtsniall
lnrnnma