PDB entry 1mpu

View 1mpu on RCSB PDB site
Description: Crystal Structure of the free human NKG2D immunoreceptor
Class: immune system
Keywords: C-type lectin-like domain, IMMUNE SYSTEM
Deposited on 2002-09-12, released 2003-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.245
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nkg2-d type II integral membrane protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mpua_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mpuA (A:)
    mnslfnqevqipltesycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvy
    skedqdllklvksyhwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkg
    yiencstpntyicmqrtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mpuA (A:)
    qipltesycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllk
    lvksyhwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpn
    tyicmqrt