PDB entry 1mpe

View 1mpe on RCSB PDB site
Description: ensemble of 20 structures of the tetrameric mutant of the b1 domain of streptococcal protein g
Deposited on 2002-09-12, released 2002-10-30
The last revision prior to the SCOP 1.63 freeze date was dated 2002-10-30, with a file datestamp of 2002-10-30.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1mpea_
  • Chain 'B':
    Domains in SCOP 1.63: d1mpeb_
  • Chain 'C':
    Domains in SCOP 1.63: d1mpec_
  • Chain 'D':
    Domains in SCOP 1.63: d1mped_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mpeA (A:)
mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mpeB (B:)
mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mpeC (C:)
mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mpeD (D:)
mqykvilngktlkgettteavdaatfekvvkqffndngvdgewtyddatktftvte