PDB entry 1mom

View 1mom on RCSB PDB site
Description: crystal structure of momordin, a type I ribosome inactivating protein from the seeds of momordica charantia
Class: protein synthesis inhibitor(toxin)
Keywords: protein synthesis inhibitor(toxin)
Deposited on 1994-03-04, released 1994-05-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.186
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: momordin
    Species: Momordica charantia [TaxId:3673]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16094 (0-245)
      • conflict (63)
    Domains in SCOPe 2.04: d1moma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1momA (A:)
    dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnydgkti
    tvaldvtnvyimgyladttsyffnepaaelasqyvfrdarrkitlpysgnyerlqiaagk
    prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
    pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
    lntrni