PDB entry 1mny

View 1mny on RCSB PDB site
Description: Dimethyl propionate ester heme-containing cytochrome b5
Class: electron transport
Keywords: heme, iron, microsomal membrane, ELECTRON TRANSPORT
Deposited on 2002-09-06, released 2002-11-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome b5
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00173 (0-93)
  Domains in SCOPe 2.06: d1mnya_
• Heterogens: HDM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mnyA (A:)
  dkdvkyytleeiqkhkdskstwvilhhkvydltkfleehpggeevlreqaggdatenfed
  vghstdarelsktyiigelhpddrskiakpsetl