PDB entry 1mnl

View 1mnl on RCSB PDB site
Description: high-resolution solution structure of a sweet protein single-chain monellin (scm) determined by nuclear magnetic resonance spectroscopy and dynamical simulated annealing calculations, 21 structures
Class: sweet protein
Keywords: sweet protein, sweet receptor binding, alpha/beta motif
Deposited on 1998-08-06, released 1999-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: monellin
  Species: Dioscoreophyllum cumminsii [TaxId:3457]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02881 (50-End)
  Domains in SCOPe 2.07: d1mnla_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1mnlA (A:)
  geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenereikgyeyql
  yvyasdklfradisedyktrgrkllrfngpvppp
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1mnlA (A:)
  geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenereikgyeyql
  yvyasdklfradisedyktrgrkllrfngpv