PDB entry 1mlu

View 1mlu on RCSB PDB site
Description: nitric oxide recombination to double mutants of myoglobin: the role of ligand diffusion in a fluctuating heme pocket
Deposited on 1994-06-15, released 1994-08-31
The last revision prior to the SCOP 1.63 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.143
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.63: d1mlu__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mlu_ (-)
  mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
  dlkkggvtaltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg