PDB entry 1mlq

View 1mlq on RCSB PDB site
Description: structural and functional effects of apolar mutations of val68(e11) in myoglobin
Deposited on 1994-06-15, released 1995-02-07
The last revision prior to the SCOP 1.63 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: -
Resolution: 2 Å
R-factor: 0.1506
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1mlq__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mlq_ (-)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtlltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg