PDB entry 1mll

View 1mll on RCSB PDB site
Description: structural and functional effects of apolar mutations of val68(e11) in myoglobin
Deposited on 1994-06-15, released 1994-08-31
The last revision prior to the SCOP 1.63 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 1.7 Å
R-factor: 0.1567
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1mll__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mll_ (-)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtfltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg