PDB entry 1ml7

View 1ml7 on RCSB PDB site
Description: Crystal structure of nitrophorin 4 complexed with 4-iodopyrazole
Class: ligand binding protein
Keywords: NO carrier, ferric heme, iodopyrazole, lipocalin, beta barrel, conformational change, LIGAND BINDING PROTEIN
Deposited on 2002-08-30, released 2002-09-20
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.145
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrophorin 4
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1ml7a_
  • Heterogens: HEV, PYZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ml7A (A:)
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk