PDB entry 1mj2
View 1mj2 on RCSB PDB site
Description: methionine repressor mutant (q44k) plus corepressor (s-adenosyl methionine) complexed to a consensus operator sequence
Class: transcription/DNA
Keywords: transcription regulation, metj, methionine repressor, sheet-helix-helix, s-adenosyl methionine, DNA, complex (transcription regulation/DNA), transcription/DNA complex
Deposited on
1998-01-27, released
1999-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.212
AEROSPACI score: 0.3
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein (methionine repressor)
Species: Escherichia coli [TaxId:562]
Gene: METJ
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1mj2a_ - Chain 'B':
Compound: protein (methionine repressor)
Species: Escherichia coli [TaxId:562]
Gene: METJ
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1mj2b_ - Chain 'C':
Compound: protein (methionine repressor)
Species: Escherichia coli [TaxId:562]
Gene: METJ
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1mj2c_ - Chain 'D':
Compound: protein (methionine repressor)
Species: Escherichia coli [TaxId:562]
Gene: METJ
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1mj2d_ - Chain 'F':
Compound: DNA (5'-d(*tp*tp*ap*gp*ap*cp*gp*tp*cp*tp*ap*gp*ap*cp*gp*tp*cp*tp*a)-3')
- Chain 'G':
Compound: DNA (5'-d(*tp*tp*ap*gp*ap*cp*gp*tp*cp*tp*ap*gp*ap*cp*gp*tp*cp*tp*a)-3')
- Heterogens: CA, SAM, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1mj2A (A:)
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1mj2B (B:)
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1mj2C (C:)
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1mj2D (D:)
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey
- Chain 'F':
No sequence available.
- Chain 'G':
No sequence available.