PDB entry 1mht

View 1mht on RCSB PDB site
Description: covalent ternary structure of hhai methyltransferase, DNA and s-adenosyl-l-homocysteine
Class: transferase/DNA
Keywords: protein-DNA complex, double helix, overhanging base, flipped-out base, modified, transferase/DNA complex
Deposited on 1994-12-08, released 1995-06-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.174
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hhai methyltransferase)
    Species: Haemophilus haemolyticus [TaxId:726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1mhta_
  • Chain 'B':
    Compound: DNA (5'-d(p*gp*ap*tp*ap*gp*(c36)p*gp*cp*tp*ap*tp*c)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*tp*gp*ap*tp*ap*gp*(c36)p*gp*cp*tp*ap*tp*c)-3')
  • Heterogens: SAH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mhtA (A:)
    mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
    itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
    vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
    qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
    iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
    qfgnsvvinvlqyiaynigsslnfkpy
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.