PDB entry 1mbk

View 1mbk on RCSB PDB site
Description: mouse c-myb DNA-binding domain repeat 3
Class: DNA binding protein
Keywords: protooncogene product, DNA binding protein
Deposited on 1995-05-19, released 1995-07-31
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myb proto-oncogene protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1mbka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mbkA (A:)
    vkktswteeedriiyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrrkv