PDB entry 1mbi

View 1mbi on RCSB PDB site
Description: x-ray crystal structure of the ferric sperm whale myoglobin: imidazole complex at 2.0 angstroms resolution
Deposited on 1990-06-25, released 1991-10-15
The last revision prior to the SCOP 1.63 freeze date was dated 1991-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.148
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.63: d1mbi__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mbi_ (-)
  vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
  lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
  gdfgadaqgamnkalelfrkdiaakykelgyqg