PDB entry 1mbg

View 1mbg on RCSB PDB site
Description: mouse c-myb dna-binding domain repeat 2
Deposited on 1995-05-19, released 1995-07-31
The last revision prior to the SCOP 1.63 freeze date was dated 1995-07-31, with a file datestamp of 1995-08-14.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1mbg__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mbg_ (-)
    likgpwtkeedqrvielvqkygpkrwsviakhlkgrigkqcrerwhnhlnpe