PDB entry 1m8t

View 1m8t on RCSB PDB site
Description: Structure of an acidic Phospholipase A2 from the venom of Ophiophagus hannah at 2.1 resolution from a hemihedrally twinned crystal form
Class: hydrolase
Keywords: phospholipase a2 structure, twinned crystal, alpha, beta, HYDROLASE
Deposited on 2002-07-26, released 2003-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.192
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: OPHIOPHAGUS HANNAH [TaxId:8665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1m8ta_
  • Chain 'B':
    Compound: phospholipase a2
    Species: OPHIOPHAGUS HANNAH [TaxId:8665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1m8tb_
  • Chain 'C':
    Compound: phospholipase a2
    Species: OPHIOPHAGUS HANNAH [TaxId:8665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1m8tc_
  • Chain 'D':
    Compound: phospholipase a2
    Species: OPHIOPHAGUS HANNAH [TaxId:8665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1m8td_
  • Chain 'E':
    Compound: phospholipase a2
    Species: OPHIOPHAGUS HANNAH [TaxId:8665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1m8te_
  • Chain 'F':
    Compound: phospholipase a2
    Species: OPHIOPHAGUS HANNAH [TaxId:8665]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1m8tf_
  • Heterogens: CA, HEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m8tA (A:)
    hlvqfngmirctipgsipwwdysdygcycgsggsgtpvdeldrccqvhdncytqaqqlte
    cspyskrysydcsegtltckadndecaafvcdcdrvaaicfagapynkeninidtttrc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m8tB (B:)
    hlvqfngmirctipgsipwwdysdygcycgsggsgtpvdeldrccqvhdncytqaqqlte
    cspyskrysydcsegtltckadndecaafvcdcdrvaaicfagapynkeninidtttrc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m8tC (C:)
    hlvqfngmirctipgsipwwdysdygcycgsggsgtpvdeldrccqvhdncytqaqqlte
    cspyskrysydcsegtltckadndecaafvcdcdrvaaicfagapynkeninidtttrc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m8tD (D:)
    hlvqfngmirctipgsipwwdysdygcycgsggsgtpvdeldrccqvhdncytqaqqlte
    cspyskrysydcsegtltckadndecaafvcdcdrvaaicfagapynkeninidtttrc
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m8tE (E:)
    hlvqfngmirctipgsipwwdysdygcycgsggsgtpvdeldrccqvhdncytqaqqlte
    cspyskrysydcsegtltckadndecaafvcdcdrvaaicfagapynkeninidtttrc
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m8tF (F:)
    hlvqfngmirctipgsipwwdysdygcycgsggsgtpvdeldrccqvhdncytqaqqlte
    cspyskrysydcsegtltckadndecaafvcdcdrvaaicfagapynkeninidtttrc