Lineage for d1m8td_ (1m8t D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733175Species King cobra (Ophiophagus hannah), an acidic isoform [TaxId:8665] [101482] (1 PDB entry)
  8. 2733179Domain d1m8td_: 1m8t D: [91230]
    complexed with ca, hez

Details for d1m8td_

PDB Entry: 1m8t (more details), 2.1 Å

PDB Description: Structure of an acidic Phospholipase A2 from the venom of Ophiophagus hannah at 2.1 resolution from a hemihedrally twinned crystal form
PDB Compounds: (D:) phospholipase a2

SCOPe Domain Sequences for d1m8td_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8td_ a.133.1.2 (D:) Snake phospholipase A2 {King cobra (Ophiophagus hannah), an acidic isoform [TaxId: 8665]}
hlvqfngmirctipgsipwwdysdygcycgsggsgtpvdeldrccqvhdncytqaqqlte
cspyskrysydcsegtltckadndecaafvcdcdrvaaicfagapynkeninidtttrc

SCOPe Domain Coordinates for d1m8td_:

Click to download the PDB-style file with coordinates for d1m8td_.
(The format of our PDB-style files is described here.)

Timeline for d1m8td_: