PDB entry 1m4j
View 1m4j on RCSB PDB site
Description: crystal structure of the n-terminal adf-h domain of mouse twinfilin isoform-1
Class: structural protein
Keywords: mixed beta-sheet, pair of alpha-helices, structural protein
Deposited on
2002-07-03, released
2002-11-13
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.232
AEROSPACI score: 0.54
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: A6 gene product
Species: Mus musculus [TaxId:10090]
Gene: TWF
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1m4ja_ - Chain 'B':
Compound: A6 gene product
Species: Mus musculus [TaxId:10090]
Gene: TWF
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1m4jb_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1m4jA (A:)
mshqtgiqasedvkeifararngkyrllkisieneqlvvgscsppsdsweqdydsfvlpl
ledkqpcyvlfrldsqnaqgyewifiawspdhshvrqkmlyaatratlkkefggghikde
vfgtvkedvslhgykkyllsqs
Sequence, based on observed residues (ATOM records): (download)
>1m4jA (A:)
iqasedvkeifararngkyrllkisieneqlvvgscsppsdsweqdydsfvlplledkqp
cyvlfrldsqnaqgyewifiawspdhshvrqkmlyaatratlkkefggghikdevfgtvk
edvslhgykkyll
- Chain 'B':
Sequence, based on SEQRES records: (download)
>1m4jB (B:)
mshqtgiqasedvkeifararngkyrllkisieneqlvvgscsppsdsweqdydsfvlpl
ledkqpcyvlfrldsqnaqgyewifiawspdhshvrqkmlyaatratlkkefggghikde
vfgtvkedvslhgykkyllsqs
Sequence, based on observed residues (ATOM records): (download)
>1m4jB (B:)
iqasedvkeifararngkyrllkisieneqlvvgscsppsdsweqdydsfvlplledkqp
cyvlfrldsqnaqgyewifiawspdhshvrqkmlyaatratlkkefggghikdevfgtvk
edvslhgykkyll