PDB entry 1m3a

View 1m3a on RCSB PDB site
Description: Solution structure of a circular form of the truncated N-terminal SH3 domain from oncogene protein c-Crk.
Class: protein binding
Keywords: sh3, sh3 domain, circular protein, cyclized protein, adaptor protein, protein binding
Deposited on 2002-06-27, released 2003-08-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.98 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene C-crk
    Species: Mus musculus [TaxId:10090]
    Gene: CRK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q64010 (0-56)
      • engineered (0)
      • engineered (56)
    Domains in SCOPe 2.02: d1m3aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m3aA (A:)
    cyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyvekyg