PDB entry 1m2i

View 1m2i on RCSB PDB site
Description: Crystal structure of E44A/E56A mutant of cytochrome b5
Class: electron transport
Keywords: cytochrome b5, trypsin-cleaved fragment, mutant;e44a/e56a, crystal structure, electron transport
Deposited on 2002-06-24, released 2003-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome b5
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00171 (0-81)
    • engineered (41)
    • engineered (53)
  Domains in SCOPe 2.07: d1m2ia_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1m2iA (A:)
  avkyytleeiqkhnnskstwlilhykvydltkfleehpggeavlreqaggdatanfedvg
  hstdarelsktfiigelhpddr