PDB entry 1lzw

View 1lzw on RCSB PDB site
Description: Structural basis of ClpS-mediated switch in ClpA substrate recognition
Class: chaperone
Keywords: alpha-beta-protein (ClpS), alpha-protein (ClpA-ND), CHAPERONE
Deposited on 2002-06-11, released 2002-11-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.243
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein yljA
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A8Q6 (Start-105)
      • engineered (65)
    Domains in SCOPe 2.06: d1lzwa_
  • Chain 'B':
    Compound: ATP-dependent clp protease ATP-binding subunit clpa
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1lzwb_
  • Heterogens: PT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lzwA (A:)
    mgktndwldfdqlaeekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratq
    lmlavayqgkaicgvftaevaetkvamvnkyarenehpllctleka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lzwA (A:)
    ekvrdalkppsmykvilvnddytpmefvidvlqkffsydveratqlmlavayqgkaicgv
    ftaevaetkvamvnkyarenehpllctleka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1lzwB (B:)
    mlnqelelslnmafararehrhefmtvehlllallsnpsarealeacsvdlvalrqelea
    fieqttpvlpaseeerdtqptlsfqrvlqravfhvqssgrnevtganvlvaifseqesqa
    ayllrkhevsrldvvnfishgtrkde