PDB entry 1lyj

View 1lyj on RCSB PDB site
Description: dissection of helix capping in t4 lysozyme by structural and thermodynamic analysis of six amino acid substitutions at thr 59
Deposited on 1992-08-10, released 1993-10-31
The last revision prior to the SCOP 1.59 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.159
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.59: d1lyj__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lyj_ (-)
  mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngviak
  deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
  lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk