PDB entry 1lxg

View 1lxg on RCSB PDB site
Description: solution structure of alpha-cobratoxin complexed with a cognate peptide (structure ensemble)
Deposited on 2002-06-05, released 2002-11-20
The last revision prior to the SCOP 1.63 freeze date was dated 2002-11-20, with a file datestamp of 2002-11-20.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1lxga_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lxgA (A:)
  ircfitpditskdcpnghvcytktwcdafcsirgkrvdlgcaatcptvktgvdiqccstd
  ncnpfptrkrp