PDB entry 1lva

View 1lva on RCSB PDB site
Description: Crystal structure of a C-terminal fragment of Moorella thermoacetica elongation factor SelB
Class: translation
Keywords: winged-helix, translation
Deposited on 2002-05-28, released 2002-08-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.215
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Selenocysteine-specific elongation factor
    Species: Moorella thermoacetica [TaxId:1525]
    Gene: SelB(amino acids 370-634)
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46455 (0-257)
      • modified residue (40)
    Domains in SCOPe 2.04: d1lvaa1, d1lvaa2, d1lvaa3, d1lvaa4
  • Heterogens: Y1, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lvaA (A:)
gspekilaqiiqehregldwqeaatraslsleetrkllqsmaaagqvtllrvendlyais
teryqawwqavtraleefhsryplrpglareelrsryfsrlparvyqalleewsregrlq
laantvalagftpsfsetqkkllkdledkyrvsrwqppsfkevagsfnldpseleellhy
lvregvlvkindefywhrqalgeareviknlastgpfglaeardalgssrkyvlplleyl
dqvkftrrvgdkrvvvgn