PDB entry 1lup

View 1lup on RCSB PDB site
Description: Solution structure of a toxin (GsMTx2) from the tarantula, Grammostola spatulata, which inhibits mechanosensitive ion channels
Class: toxin
Keywords: inhibitor cysteine knot, beta-sheet, toxin
Deposited on 2002-05-23, released 2002-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: GsMTx2
  Species: Grammostola rosea [TaxId:432528]
  Database cross-references and differences (RAF-indexed):
  • PDB 1LUP (0-30)
  Domains in SCOPe 2.07: d1lupa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1lupA (A:)
  ycqkwmwtcdeerkcceglvcrlwckriinm