PDB entry 1lri

View 1lri on RCSB PDB site
Description: beta-cryptogein-cholesterol complex
Class: toxin
Keywords: cryptogein, cholesterol, sterol carrier protein, TOXIN
Deposited on 2002-05-15, released 2002-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.161
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-elicitin cryptogein
    Species: Phytophthora cryptogea [TaxId:4786]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15570 (0-97)
      • see remark 999 (5)
    Domains in SCOPe 2.07: d1lria_
  • Heterogens: CL, CLR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1lriA (A:)
tactasqqtaayktlvsilsdasfnqcstdsgysmltakalpttaqyklmcastacntmi
kkivtlnppncdltvptsglvlnvysyangfsnkcssl